PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539371.1_FGP014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 199aa    MW: 22544.5 Da    PI: 8.4847
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539371.1_FGP014genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.5e-1047104562
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                        kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  KN539371.1_FGP014  47 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 104
                        999******************************************9999887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-1643107IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.56545108IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.0E-1147103No hitNo description
SuperFamilySSF579594.22E-114797No hitNo description
PfamPF001701.1E-947105IPR004827Basic-leucine zipper domain
CDDcd147032.36E-184897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGKLSFAANG EPAKFSLEFG SGEFTPAEMK RIMADEKLAE MALADPKRVK RVLANRQSAA  60
RSKERRMRYI AELEQKVQIL QTEATTLSAQ LTLLQRDSSG MATQNNELKF RLQSMEQQAQ  120
LRDALNEALT AEVQRLKLAA NEVGDTSSSS NLAHQIQLRC QNQMLDLHKQ QQQQVEQIPF  180
YQLEQPEQQN GTARNHESK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.11e-138PREDICTED: transcription factor RF2a-like
SwissprotQ69IL43e-50RF2A_ORYSJ; Transcription factor RF2a
TrEMBLQ8LN441e-138Q8LN44_ORYSJ; BZIP transcription factor family protein, expressed
STRINGLOC_Os10g38820.11e-137(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-53bZIP family protein